Browse result page of CancerPDF Database

Please click on CancerPDF_ID for detailed information about peptide.

CancerPDF_IDPeptide seqProtein NameFluidMass/ZProfiling TechniqueCancer Type Expression RegulationPUBMED ID
CancerPDF_ID11033 KEDIDTSSKGGCVQRNA-binding protein 6Serum1466.98MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11034 AILVDLEPGTMDSVRtubulin beta chainSerum1618.22MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11035 IHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELNzinc finger protein 3 Serum5905.23MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11036 NANASerum1866.63MALDI-TOFClear cell renal carcinoma "Downregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11037 NANASerum3317MALDI-TOFClear cell renal carcinoma "Downregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11038 NANASerum6433.36MALDI-TOFClear cell renal carcinoma "Downregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11039 NANASerum1780.1MALDI-TOFClear cell renal carcinoma "Downregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11040 NANASerum1061.34MALDI-TOFClear cell renal carcinoma "Downregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11041 NANASerum5752.25MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11042 NANASerum5724.76MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11043 NANASerum5844.36MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11044 NANASerum5739.69MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11045 NANASerum5818.83MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11046 NANASerum4091.86MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11047 NANASerum1714.57MALDI-TOFClear cell renal carcinoma "Upregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11048 NANASerum1981.69MALDI-TOFClear cell renal carcinoma "Downregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11049 NANASerum1077.14MALDI-TOFClear cell renal carcinoma "Downregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11050 NANASerum1547MALDI-TOFClear cell renal carcinoma "Downregulated in ccRCC, preoperative and post operative patients vs control" 25368985
CancerPDF_ID11074 NAC1RL_HUMANUrine1023.889MALDI-TOFClear cell renal carcinoma NA 26482227
CancerPDF_ID11075 NAPTGDS_HUMANUrine1525MALDI-TOFClear cell renal carcinoma NA 26482227
CancerPDF_ID11076 NAA1AG1_HUMANUrine1755.759MALDI-TOFClear cell renal carcinoma "Upregulated with increse in tumor mass,primary tumor stage" 26482227
CancerPDF_ID11077 NAA1AG2_HUMANUrine1755.759MALDI-TOFClear cell renal carcinoma "Upregulated with increse in tumor mass,primary tumor stage" 26482227
CancerPDF_ID11078 NAZA2G_HUMANUrine1825.638MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11079 NAPGBM_HUMANUrine1825.638MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11080 NAUROM_HUMANUrine1912.106MALDI-TOFClear cell renal carcinoma Downregulated with increse in tumor mass 26482227
CancerPDF_ID11081 NAMMP23_HUMANUrine1934.197MALDI-TOFClear cell renal carcinoma Downregulated with increse in tumor mass 26482227
CancerPDF_ID11082 NAMYH1_HUMANUrine1934.197MALDI-TOFClear cell renal carcinoma Downregulated with increse in tumor mass 26482227
CancerPDF_ID11083 NAMYH4_HUMANUrine1934.197MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11084 NAGP162_HUMANUrine2192.065MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11085 NAKPB1_HUMANUrine2192.065MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11086 NAFIBA_HUMANUrine2660.82MALDI-TOFClear cell renal carcinoma Upregulated with increse in tumor mass 26482227
CancerPDF_ID11087 NAHBA_HUMANUrine2790.7MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11088 NAADA19_HUMANUrine3151.096MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11089 NARSPH3_HUMANUrine3151.096MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11090 NADREB_HUMANUrine3571.126MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11091 NAG3P_HUMANUrine3723.84MALDI-TOFClear cell renal carcinoma Downregulated with increse in tumor mass 26482227
CancerPDF_ID11092 NANOTC2_HUMANUrine4026.883MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11093 NASAFB2_HUMANUrine4355.12MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11094 NACC168_HUMANUrine4626.92MALDI-TOFClear cell renal carcinoma "Differentially expression in control vs ccRCC cancer, Primary Tumor or grade" 26482227
CancerPDF_ID11095 NAPTGDS_HUMANUrine1525MALDI-TOFClear cell renal carcinoma Downregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11096 NAA1AG1_HUMANUrine1755.8MALDI-TOFClear cell renal carcinoma Downregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11097 NAA1AG2_HUMANUrine1755.8MALDI-TOFClear cell renal carcinoma Downregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11098 NAGP162_HUMANUrine2192.1MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11099 NAKPB1_HUMANUrine2192.1MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11100 NAHBA_HUMANUrine2790.7MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11101 NASAFB2_HUMANUrine4355.1MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11102 NACC168_HUMANUrine4626.9MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11103 NANAUrine1219.1MALDI-TOFClear cell renal carcinoma Downregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11104 NANAUrine2282.1MALDI-TOFClear cell renal carcinoma Downregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11105 NANAUrine4366.9MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11106 NANAUrine4439.1MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11107 NANAUrine4751.5MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11108 NANAUrine5514.2MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11109 NANAUrine6237.8MALDI-TOFClear cell renal carcinoma Upregulated in pT1b compared to pT1a patients 26482227
CancerPDF_ID11110 NANAUrine1023.9MALDI-TOFClear cell renal carcinoma Upregulated in grade vs normal 26482227
CancerPDF_ID11111 NANAUrine1194.2MALDI-TOFClear cell renal carcinoma Upregulated in grade vs normal 26482227
CancerPDF_ID11112 NANAUrine1825.6MALDI-TOFClear cell renal carcinoma Upregulated in grade vs normal 26482227
CancerPDF_ID11113 NANAUrine3723.8MALDI-TOFClear cell renal carcinoma Downregulated in grade vs normal 26482227
CancerPDF_ID11114 NANAUrine3571.1MALDI-TOFClear cell renal carcinoma Upregulated in grade vs normal 26482227
CancerPDF_ID11115 NANAUrine4355.1MALDI-TOFClear cell renal carcinoma Downregulated in grade vs normal 26482227
CancerPDF_ID11116 NANAUrine4751.5MALDI-TOFClear cell renal carcinoma Downregulated in grade vs normal 26482227
CancerPDF_ID11117 NANAUrine5004.4MALDI-TOFClear cell renal carcinoma Downregulated in grade vs normal 26482227
CancerPDF_ID11118 NANAUrine5027.8MALDI-TOFClear cell renal carcinoma Downregulated in grade vs normal 26482227
CancerPDF_ID11119 NANAUrine5043.6MALDI-TOFClear cell renal carcinoma Downregulated in grade vs normal 26482227
CancerPDF_ID11120 NANAUrine5231.5MALDI-TOFClear cell renal carcinoma Upregulated in grade vs normal 26482227
CancerPDF_ID11121 NANAUrine1755.8MALDI-TOFClear cell renal carcinoma Upregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11122 NANAUrine1894.3MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11123 NANAUrine1912.1MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11124 NANAUrine1934.2MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11125 NANAUrine2660.8MALDI-TOFClear cell renal carcinoma Upregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11126 NANAUrine2961.1MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11127 NANAUrine4026.9MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11128 NANAUrine4638.5MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11129 NANAUrine4751.5MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11130 NANAUrine4962.8MALDI-TOFClear cell renal carcinoma Upregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11131 NANAUrine5231.5MALDI-TOFClear cell renal carcinoma Upregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11132 NANAUrine5578.2MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11133 NANAUrine6261.4MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11134 NANAUrine6305.2MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227
CancerPDF_ID11135 NANAUrine8181.9MALDI-TOFClear cell renal carcinoma Downregulated in ccRCC vs normal according to primary tumor Stage 26482227